myswisskitchen.swisshikingvacations.comMy Swiss Kitchen - Feeding Foodies in the Alps

myswisskitchen.swisshikingvacations.com Profile

Myswisskitchen.swisshikingvacations.com is a subdomain of Swisshikingvacations.com, which was created on 2013-12-04,making it 11 years ago. It has several subdomains, such as switzerlandtravel.swisshikingvacations.com alpshiking.swisshikingvacations.com , among others.

Description:Feeding Foodies in the...

Discover myswisskitchen.swisshikingvacations.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

myswisskitchen.swisshikingvacations.com Information

HomePage size: 174.146 KB
Page Load Time: 0.883082 Seconds
Website IP Address: 162.240.52.86

myswisskitchen.swisshikingvacations.com Similar Website

Oisans Valley: Outdoor Adventures in the French Alps
uk.oisans.com
Bike Oisans | All the info on mountain biking and cycling in Oisans in the French Alps
uk.bike-oisans.com
Home - Polish Foodies
shop.polishfoodies.com
Alpenwild - Alps Hiking
alpshiking.swisshikingvacations.com
Feeding Matters – Infant and Child Feeding Questionnaire©
questionnaire.feedingmatters.org
Swiss Rifles dot com - The message board is dedicated to the arms and equipment carried by Swiss sol
theswissriflesdotcommessageboard.yuku.com
Welcome to the Swiss Bakery Online Shop-n-Ship | Gourmet Swiss Foods, Cheese for Raclette, Sausages
theswissbakeryonline.americommerce.com
The Alps Trail Running Guide
elevation.alpsinsight.com
Swiss Re 2023 Annual Report | Swiss Re Annual Report
reports.swissre.com
CIA Foodies - Experience the World of Food with Culinary Institute of America
enthusiasts.ciachef.edu
The Alpine Property Blog - Selling properties in the Alps since 1999
blog.alpine-property.com
Alps Tour Golf |
wp-alpstour.ocs-sport.com
Alps
testseries.thealpsltd.com
FIDE Grand Swiss 2023 – FIDE Grand Swiss 2023 chess tournament official
grandswiss.fide.com

myswisskitchen.swisshikingvacations.com PopUrls

My Swiss Kitchen - Feeding Foodies in the Alps
https://myswisskitchen.swisshikingvacations.com/
“Herbage” - My Swiss Kitchen - Alpenwild
https://myswisskitchen.swisshikingvacations.com/herbage/
The History Of Garlic - My Swiss Kitchen - Alpenwild
https://myswisskitchen.swisshikingvacations.com/garlic/
Natural Wild Yeast - My Swiss Kitchen - Alpenwild
https://myswisskitchen.swisshikingvacations.com/wildyeast/
Cucumber Dill Salad - My Swiss Kitchen - Alpenwild
https://myswisskitchen.swisshikingvacations.com/dill/
Delicious Italian Creamy Polenta Recipe - My Swiss Kitchen
https://myswisskitchen.swisshikingvacations.com/polenta/
The Need To Taste Raclette Should Be On Everyone's Bucket ...
https://myswisskitchen.swisshikingvacations.com/raclette/
Easy Crispy Onion Topping Recipe - My Swiss Kitchen
https://myswisskitchen.swisshikingvacations.com/onions/
Pizzaiolo with Raclette - My Swiss Kitchen
https://myswisskitchen.swisshikingvacations.com/pizzaiolo/
Easy Saffron Creme Brulee Recipe - My Swiss Kitchen
https://myswisskitchen.swisshikingvacations.com/redgold/

myswisskitchen.swisshikingvacations.com Httpheader

Date: Mon, 13 May 2024 00:27:33 GMT
Server: Apache
Link: https://myswisskitchen.swisshikingvacations.com/wp-json/; rel="https://api.w.org/"
Cache-Control: max-age=7200
Expires: Mon, 13 May 2024 02:27:33 GMT
X-Endurance-Cache-Level: 2
X-nginx-cache: WordPress
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

myswisskitchen.swisshikingvacations.com Meta Info

charset="utf-8"/
content="width=device-width, initial-scale=1" name="viewport"/
content="Feeding Foodies in the Alps" name="description"
content="max-image-preview:large" name="robots"
content="All in One SEO (AIOSEO) 4.6.2" name="generator"/
content="en_US" property="og:locale"/
content="My Swiss Kitchen - Feeding Foodies in the Alps" property="og:site_name"/
content="website" property="og:type"/
content="My Swiss Kitchen - Feeding Foodies in the Alps" property="og:title"/
content="Feeding Foodies in the Alps" property="og:description"/
content="https://myswisskitchen.swisshikingvacations.com/" property="og:url"/
content="summary" name="twitter:card"/
content="My Swiss Kitchen - Feeding Foodies in the Alps" name="twitter:title"/
content="Feeding Foodies in the Alps" name="twitter:description"/
content="Feeding Foodies in the Alps" name="description"/
content="My Swiss Kitchen" property="og:title"/
content="My Swiss Kitchen" property="og:site_name"/
content="summary_large_image" name="twitter:card"/
content="https://myswisskitchen.swisshikingvacations.com/wp-content/uploads/2019/04/cropped-Alpenwild-Logo-New-2019-favicon-photoshop-270x270.png" name="msapplication-TileImage"/

myswisskitchen.swisshikingvacations.com Ip Information

Ip Country: United States
City Name: Meridian
Latitude: 43.6138
Longitude: -116.3972
Marker
Latitude: 43.6138
Longitude: -116.3972
Leaflet © OpenStreetMap contributors

myswisskitchen.swisshikingvacations.com Html To Plain Text

Trips Hike Crete Sea to Summit Provence Best of the Swiss Alps Exploring The Jungfrau Italian Dolomites Best of the French Alps St Moritz to Italy Exploring Croatia Italian Lakes Discovery Best of Slovenia and the Julian Alps Trek Tour of the Giants Italian Dolomites Alta Via 1 Chamonix-Zermatt Haute Route Deluxe Haute Route Deluxe Tour du Mont Blanc Via Alpina - Swiss Alpine Route Deluxe Bernese Oberland Traverse Eiger to the Matterhorn England Coast to Coast Rail and Sightseeing Scenic Alps by Rail Cheese, Chocolate, & the Alps Self-Guided - Scenic Alps by Rail Self-Guided- Glacier Express Christmas in Switzerland Scenic Alps by Rail - Christmas Edition Self-Guided Tours Self-Guided Haute Route Self-Guided Tour du Mont Blanc Self-Guided Jungfrau Self-Guided Via Alpina Self-Guided Bernese Oberland Traverse Self-Guided Eiger to the Matterhorn Self-Guided Swiss Alps Self-Guided Austria Zillertal Alps Custom and Guided Tours Private Guided and Custom Trips Tour Add-Ons & Getaways Appenzell -Alpstein Range Zermatt and the Matterhorn Leukerbad -Thermal Hot Springs Principality of Liechtenstein Saas-Fee - Pearl of the Alps Tour Calendar About Our Tours Where We Stay How We Travel FAQ Guided Tours FAQ – Alpenwild Experience FAQ - Tour du Mont Blanc FAQ - Haute Route FAQ - Alps Hiking Tours FAQ- Scenic Alps by Rail Tour FAQ Self-Guided Tours A Self-Guided Tour FAQ Self-Guided FAQ - Haute Route Self-Guided FAQ - Tour du Mont Blanc Self-Guided FAQ - Rail Tours Travel Agents + Alpenwild Why You’ll Love The Alps Plan a Trip Packing Lists Packing List – Alps Trekking Tours Packing List – Alps Hiking Tours Packing List – Alps Walking and Sightseeing Tours Packing List - Winter Tours- Christmas in Switzerland Weather In The Alps Haute Route Essentials Tour du Mont Blanc Essentials Is a Self-Guided Trip for me? Car Travel in Switzerland Maps & Books Book a Trip Book Your Trip Make a PaymentSustainability Commitment Why Choose Alpenwild The Alpenwild Story Guides and Trip Leaders Contact Us 801-226-9026Trip Finder Newsletter Signup Request a Call 801-226-9026 Trips Hike Crete Sea to Summit Provence Best of the Swiss Alps Exploring The Jungfrau Italian Dolomites Best of the French Alps St Moritz to Italy Exploring Croatia Italian Lakes Discovery Best of Slovenia and the Julian Alps Trek Tour of the Giants Italian Dolomites Alta Via 1 Chamonix-Zermatt Haute Route Deluxe Haute Route Deluxe Tour du Mont Blanc Via Alpina - Swiss Alpine Route Deluxe Bernese Oberland Traverse Eiger to the Matterhorn England Coast to Coast Rail and Sightseeing Scenic Alps by Rail Cheese, Chocolate, & the Alps Self-Guided - Scenic Alps by Rail Self-Guided- Glacier Express Christmas in Switzerland Scenic Alps by Rail - Christmas Edition Self-Guided Tours Self-Guided Haute Route Self-Guided Tour du Mont Blanc Self-Guided Jungfrau Self-Guided Via Alpina Self-Guided Bernese Oberland Traverse Self-Guided Eiger to the Matterhorn Self-Guided Swiss Alps Self-Guided Austria Zillertal Alps Custom and Guided Tours Private Guided and Custom Trips Tour Add-Ons & Getaways Appenzell -Alpstein Range Zermatt and the Matterhorn Leukerbad -Thermal Hot Springs Principality of Liechtenstein Saas-Fee - Pearl of the Alps Tour Calendar About Our Tours Where We Stay How We Travel FAQ Guided Tours FAQ – Alpenwild Experience FAQ - Tour du Mont Blanc FAQ - Haute Route FAQ - Alps Hiking Tours FAQ- Scenic Alps by Rail Tour FAQ Self-Guided Tours A Self-Guided Tour FAQ Self-Guided FAQ - Haute Route Self-Guided FAQ - Tour du Mont Blanc Self-Guided FAQ - Rail Tours Travel Agents + Alpenwild Why You’ll Love The Alps Plan a Trip Packing Lists Packing List – Alps Trekking Tours Packing List – Alps Hiking Tours Packing List – Alps Walking and Sightseeing Tours Packing List - Winter Tours- Christmas in Switzerland Weather In The Alps Haute Route Essentials Tour du Mont Blanc Essentials Is a Self-Guided Trip for me? Car Travel in Switzerland Maps & Books Book a Trip Book Your Trip Make a PaymentSustainability Commitment Why Choose Alpenwild The Alpenwild Story Guides and Trip Leaders Contact Us My Swiss Kitchen Feeding Foodies in the Alps Are you hoping to learn more about cuisine in Switzerland? We’ve got you covered! Read more hear. Rather not read? Join us on a tour! Travel and Coronavirus: A Message to Our GuestsLoad More Subscribe to the Blog Be the first to learn more about Swiss cuisine! Name Email* Please leave this field empty. Swiss Food Guide Cheese of the Month Desserts For Your Kitchen Herb of the week Lifestyle Northern Region Popular Ingredients Restaurants South Eastern Region South Western Region Swiss Cuisine Uncategorized Western Region Most Popular Posts Carac Pastry With Dark Chocolate Ganache Recipe Classic Rösti Recipe Swiss Carac: Mysterious Chocolate Pastry of Suisse Romande A Savory Raclette Omelet from the Savoy Region Archives Archives Select Month December 2022 September 2019 May 2019 April 2019 March 2019 February 2019 January 2019 October 2018 September 2018 July 2018 June 2018 May 2018 April 2018 March 2018 February 2018 January 2018 December 2017 October 2017 September 2017 August 2017 July 2017 Sign Up for Our Email Newsletter Stay up to date on the latest Alpenwild news. You’re free to opt out at any time. Interests: Hiking and trekking Cultural and gourmet Ski and winter Subscribe Blogs Alps Hiking Blog Switzerland Travel Blog Swiss Food Blog What’s New? Alpenwild in the News Alpenwild Press Room Careers Necessary Info Terms & Conditions Trip insurance Privacy Policy Sitemap Happy Guests Testimonials Returning Guest Perks Alpenwild Recommended Suggested Reading Sustainability Commitment Eco-friendly Travel Videos Copyright © 2005-2024 alpenwild.com. All rights reserved Name * Phone Number * Best time to call (indicate your time zone) * Questions or Comments * Call Me Back Choose Locations * All Locations Austria France Italy Switzerland Slovenia Liechtenstein Ireland Croatia Great Britain Greece Choose Activities * All Activities Culture & History Food & Wine Rail Sightseeing Ski & Winter Trekking/Hiking Walking Spa & Wellness Mountain Scenery Wildlife Choose Date * All Dates January February March April May June July August September October November December Find My Trip First Name * Last Name * Email Address * Interests Hiking and trekking Cultural and gourmet Ski and winter See our Privacy Policy....

myswisskitchen.swisshikingvacations.com Whois

Domain Name: SWISSHIKINGVACATIONS.COM Registry Domain ID: 1837909687_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2024-04-29T19:04:04Z Creation Date: 2013-12-04T14:54:23Z Registry Expiry Date: 2024-10-06T11:59:59Z Registrar: NameCheap, Inc. Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.6613102107 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DNS1.REGISTRAR-SERVERS.COM Name Server: DNS2.REGISTRAR-SERVERS.COM DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T15:02:42Z <<<